BHMT Recombinant monoclonal antibody

• 

  WB analysis using 86372-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86372-1-RR (BHMT antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of rat liver using 86372-1-RR

  IP result of anti-BHMT (IP:86372-1-RR, 4ug; Detection:86372-1-RR 1:3000) with rat liver tissue lysate 3080 ug.

• 

  Affinity and Kinetic Characterization of 86372-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86372-1-RR against Human BHMT were performed. The affinity constant is below 1 pM.

BHMT Uni-rAb^® Recombinant Antibody for WB, IP, ELISA

Cat No. 86372-1-RR

Clone No.250978E3

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IP, ELISA

Synonyms

Betaine--homocysteine S-methyltransferase 1, EC:2.1.1.5

---

Tested Applications

• Positive WB detected in: rat liver tissue, human kidney tissue
• Positive IP detected in: rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86372-1-RR targets BHMT in WB, IP, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8738

  Product name: Recombinant human BHMT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-406 aa of BC012616

  Sequence: MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ

• Full Name: betaine-homocysteine methyltransferase
• Calculated Molecular Weight: 406 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC012616
• Gene Symbol: BHMT
• Gene ID (NCBI): 635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q93088
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Betaine-homocysteine methyltransferase (BHMT) is a cytosolic enzyme that Involved in the regulation of homocysteine metabolism. BHMT catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline(PMID: 8798461, 10529246).