BLM Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BLM Polyclonal antibody, PBS Only (30254-1-PBS)

• 

  WB analysis using 30254-1-AP (same clone as 30254-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30254-1-AP (BLM antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30254-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30254-1-AP (same clone as 30254-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30254-1-AP (BLM antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30254-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30254-1-AP (same clone as 30254-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30254-1-AP (BLM antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30254-1-PBS in a different storage buffer formulation.

BLM Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30254-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

RECQL3, RECQL2, RECQ2, BS

---

Product Information

30254-1-PBS targets BLM in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32996

  Product name: Recombinant human BLM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1235-1417 aa of

  Sequence: VHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDSSPGISLSSSRGPGRSAAEELDEEIPVSSHYFASKTRNERKRKKMPASQRSKRRKTASSGSKAKGGSATCRKISSKTKSSSIIGSSSASHTSQATSGANSKLGIMAPPKPINRPFLKPSYAFS

• Full Name: Bloom syndrome, RecQ helicase-like
• Calculated Molecular Weight: 159 kDa
• Observed Molecular Weight: 160-175 kDa
• Gene Symbol: BLM
• Gene ID (NCBI): 641
• RRID: AB_3086282
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54132
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BLM participates in DNA replication and repair, it is involved in 5'-end resection of DNA during double-strand break (DSB) repair. BLM can also be recruited by the KHDC3L-OOEP scaffold to DNA replication forks where it is retained by TRIM25 ubiquitination, it thereby promotes the restart of stalled replication forks.