BLNK Monoclonal antibody

BLNK Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66953-1-Ig
Clone No.1A1A1

Host / Isotype

Mouse / IgG1

Reactivity

Human, pig, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

B cell linker, B cell linker protein, BASH, BLNK, BLNK S, Cytoplasmic adapter protein, LY57, SLP 65, SLP65

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman spleen tissue, Raji cells, Daudi cells, Ramos cells, pig spleen tissue
Positive IHC detected inhuman appendicitis tissue, mouse thymus tissue, rat spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inRaji cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:3000-1:8000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66953-1-Ig targets BLNK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, pig, mouse, rat samples.

Tested Reactivity Human, pig, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28673

Product name: Recombinant human BLNK protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-456 aa of BC018906

Sequence: MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS

Predict reactive species
Full Name B-cell linker
Calculated Molecular Weight 50 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC018906
Gene Symbol BLNK
Gene ID (NCBI) 29760
RRIDAB_2882276
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8WV28
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BLNK (also known as SLP-65 or BASH) is an important adaptor protein selectively expressed in B-lineage cells. BLNK bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. BLNK has been shown to be necessary for BCR-mediated Ca2+ mobilization, for the activation of mitogen-activated protein kinases such as ERK, JNK, and p38 in a chicken B cell line DT40, and for activation of transcription factors such as NF-AT and NF-κB in human or mouse B cells. BLNK plays a crucial role in pre-BCR-dependent progression of B cell development, BCR-mediated B cell survival, activation, proliferation, and T-independent immune responses.

Protocols

Product Specific Protocols
IF protocol for BLNK antibody 66953-1-IgDownload protocol
IHC protocol for BLNK antibody 66953-1-IgDownload protocol
WB protocol for BLNK antibody 66953-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...