BLVRA Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• BLVRA Recombinant monoclonal antibody, PBS Only (88427-1-PBS)

BLVRA Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 88427-1-PBS

Clone No.260945E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Biliverdin IX alpha reductase, biliverdin reductase A, Biliverdin-IX alpha-reductase, BLVR, BVR

• 

  WB analysis using 88427-1-RR (same clone as 88427-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88427-1-RR (BLVRA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88427-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 88427-1-RR (same clone as 88427-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 88427-1-RR (BLVRA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88427-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88427-1-PBS targets BLVRA in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1166

  Product name: Recombinant human BLVRA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-296 aa of BC008456

  Sequence: MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK

• Full Name: biliverdin reductase A
• Calculated Molecular Weight: 33.2 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC008456
• Gene Symbol: BLVRA
• Gene ID (NCBI): 644
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P53004
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BLVRA(Biliverdin reductase A) is also named as BLVR, BVR and belongs to the biliverdin reductase subfamily.It catalyze the conversion of biliverdin to bilirubin in the presence of NADPH or NADH.This protein can exsit as a dimer(PMID:11773068). Defects in BLVRA are the cause of hyperbiliverdinemia (HBLVD).