BLVRA Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• BLVRA Recombinant monoclonal antibody (88427-1-RR)

BLVRA Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 88427-1-RR

Clone No.260945E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Biliverdin IX alpha reductase, biliverdin reductase A, Biliverdin-IX alpha-reductase, BLVR, BVR

• 

  WB analysis using 88427-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88427-1-RR (BLVRA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 88427-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 88427-1-RR (BLVRA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A549 cells, Daudi cells, DU 145 cells, ACHN cells, PANC-1 cells, 786-O cells, HepG2 cells
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88427-1-RR targets BLVRA in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1166

  Product name: Recombinant human BLVRA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-296 aa of BC008456

  Sequence: MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK

• Full Name: biliverdin reductase A
• Calculated Molecular Weight: 33.2 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC008456
• Gene Symbol: BLVRA
• Gene ID (NCBI): 644
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P53004
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BLVRA(Biliverdin reductase A) is also named as BLVR, BVR and belongs to the biliverdin reductase subfamily.It catalyze the conversion of biliverdin to bilirubin in the presence of NADPH or NADH.This protein can exsit as a dimer(PMID:11773068). Defects in BLVRA are the cause of hyperbiliverdinemia (HBLVD).