BMPR1A Recombinant monoclonal antibody

• 

  WB analysis using 82928-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82928-1-RR (BMPR1A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 82928-1-RR

  IP result of anti-BMPR1A (IP:82928-1-RR, 4ug; Detection:82928-1-RR 1:2000) with HEK-293 cells lysate 1920 ug.

• 

  FC experiment of MCF-7 using 82928-1-RR

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug BMPR1A Recombinant antibody (82928-1-RR, Clone:230137B7) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

BMPR1A Uni-rAb^® Recombinant Antibody for WB, FC (Intra), IP, ELISA

Cat No. 82928-1-RR

Clone No.230137B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), IP, ELISA

Synonyms

230137B7, Activin receptor like kinase 3, Activin receptor-like kinase 3, ACVRLK3, ALK 3

---

Tested Applications

• Positive WB detected in: Jurkat cells, U2OS cells, HEK-293 cells, mouse heart tissue
• Positive IP detected in: HEK-293 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82928-1-RR targets BMPR1A in WB, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3410

  Product name: Recombinant human BMPR1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 174-427 aa of BC028383

  Sequence: FCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIM

• Full Name: bone morphogenetic protein receptor, type IA
• Calculated Molecular Weight: 532 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC028383
• Gene Symbol: BMPR1A
• Gene ID (NCBI): 657
• RRID: AB_3670667
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P36894
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BMPR1A (Bone morphogenetic protein receptor type-1A) is also named as ACVRLK3, ALK3 and SKR5. BMPR1A is an essential receptor for BMP signaling (PMID: 26279380). BMPR1A is necessary for chondrogenesis and osteogenesis (PMID: 32764110). BMPR1A is a cell surface marker of human SuSCs (PMID: 33658353).