BMSC UbP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BMSC UbP Polyclonal antibody, PBS Only (11564-1-PBS)

• 

  WB analysis using 11564-1-AP (same clone as 11564-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11564-1-AP (BMSC UbP antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11564-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 11564-1-AP (same clone as 11564-1-PBS)

  IP result of anti-BMSC UbP (IP:11564-1-AP, 4ug; Detection:11564-1-AP 1:1000) with HeLa cells lysate 2000ug. This data was developed using the same antibody clone with 11564-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11564-1-AP (same clone as 11564-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11564-1-AP (BMSC UbP antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11564-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11564-1-AP (same clone as 11564-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 11564-1-AP (BMSC UbP antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11564-1-PBS in a different storage buffer formulation.

BMSC UbP Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 11564-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

BMSCUBP, BMSC-UbP, Bone marrow stromal cell ubiquitin-like protein, SB132, Ubiquitin-like protein 7

---

Product Information

11564-1-PBS targets BMSC UbP in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2130

  Product name: Recombinant human UBL7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-380 aa of BC030055

  Sequence: MSLSDWHLAVKLADQPLTPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAAMREFRVLHTALHSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVPAHPALVNAIVLVLHSVAGSAPMPGTDSSSRSMPSSSYRDMPGGFLFEGLSDDEDDFHPNTRSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP

• Full Name: ubiquitin-like 7 (bone marrow stromal cell-derived)
• Calculated Molecular Weight: 380 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC030055
• Gene Symbol: UBL7
• Gene ID (NCBI): 84993
• RRID: AB_2212080
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96S82
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ubiquitin is an important cellular signal that targets proteins for degradation or regulates their functions. UBL7 (ORF name SB132) encodes ubiquitin-like protein7 also named bone marrow stromal cell ubiquitin-like protein (BMSC-UbP) capable of binding ubiquitin. BMSC-UbP protein is derived from bone marrow stromal cells containing a ubiquitin-associated (UBA) domain at the C terminus that has been implicated in linking cellular processes and the ubiquitin system. BMSC-UbP mRNA is widely expressed in human multiple tissues and various tumor cell lines and is decreased in BMSC stimulated with phorbol myristate acetate (PMA) suggesting a role in regulation of BMSC function.