CoraLite® Plus 488-conjugated BOP1 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-82742-3

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 BOP1 antibody (CL488-82742-3, Clone: 3A4 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

BOP1 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-82742-3

Clone No.3A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

3A4, block of proliferation 1, KIAA0124

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82742-3 targets BOP1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26669

  Product name: Recombinant human BOP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-135 aa of BC013787

  Sequence: MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGDEYAEDSSDEEDIRNT

• Full Name: block of proliferation 1
• Calculated Molecular Weight: 84 kDa
• Observed Molecular Weight: 117 kDa
• GenBank Accession Number: BC013787
• Gene Symbol: BOP1
• Gene ID (NCBI): 23246
• RRID: AB_3673077
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14137
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Block of Proliferation 1(BOP1) protein was first isolated from a mouse, and the truncation protein may led to cell cycle arrest. Bop1 plays a role in processing of the 28S and 5.8S rRNAs (ribosomal RNAs) to regulate ribosome biogenesis. And Bop1 also act as a component of Pes1/Bop1/WDR21 (PeBoW) complex for mature 60S ribosome, and consequently acts during cell division at G1 checkpoints (PMID:18670790; PMID:26940494). What's more, abnormal expression of BOP1 was associated with liver or colorectal cancers (PMID:16804918). The molecular weight of the protein we detected was slightly higher, about 117 kd, which is also seen in the article (PMID: 30100995).