• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated BOP1 Recombinant monoclonal antibody

BOP1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-82742-3
Clone No.3A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

3A4, block of proliferation 1, KIAA0124

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82742-3 targets BOP1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag26669

Product name: Recombinant human BOP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-135 aa of BC013787

Sequence: MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGDEYAEDSSDEEDIRNT

Predict reactive species
Full Name block of proliferation 1
Calculated Molecular Weight 84 kDa
Observed Molecular Weight 117 kDa
GenBank Accession NumberBC013787
Gene Symbol BOP1
Gene ID (NCBI) 23246
RRIDAB_3673077
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14137
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Block of Proliferation 1(BOP1) protein was first isolated from a mouse, and the truncation protein may led to cell cycle arrest. Bop1 plays a role in processing of the 28S and 5.8S rRNAs (ribosomal RNAs) to regulate ribosome biogenesis. And Bop1 also act as a component of Pes1/Bop1/WDR21 (PeBoW) complex for mature 60S ribosome, and consequently acts during cell division at G1 checkpoints (PMID:18670790; PMID:26940494). What's more, abnormal expression of BOP1 was associated with liver or colorectal cancers (PMID:16804918). The molecular weight of the protein we detected was slightly higher, about 117 kd, which is also seen in the article (PMID: 30100995).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 BOP1 antibody CL488-82742-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...