Use Able AI chat for product recommendations

BOULE Polyclonal antibody, PBS Only

BOULE Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA

Cat No. 13720-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA

BOLL, Protein boule-like

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

13720-1-PBS targets BOULE in WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4662

Product name: Recombinant human BOLL protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-283 aa of BC033674

Sequence: MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

Predict reactive species
Full Name bol, boule-like (Drosophila)
Calculated Molecular Weight 283 aa, 31 kDa
Observed Molecular Weight 38-42 kDa
GenBank Accession NumberBC033674
Gene Symbol BOULE
Gene ID (NCBI) 66037
RRIDAB_2290617
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N9W6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BOULE, also called BOLL, belongs to the RRM DAZ family. BOULE has been identified as being involved in regulating the development and differentiation of germ cells and playing an essential role in infertility (PMID: 31683986). BOULE is specifically expressed in testis, but not in early embryos, primordial germ cells, and spermatogonial cells. It is first expressed in the cytoplasm of spermatocytes and then persists through meiosis. BOULE has 5 isoforms with the molecular mass of 19 and 31-38 kDa. This antibody detects two bands in testis, the lower band of ~40 kDa in size corresponds to the predicted endogenous BOULE protein, while the upper band may be an isoform or posttranslationally modified version of the BOULE protein (PMID: 27632217).

Loading...
||
New chat

Able

正在加载,请稍候...