CoraLite® Plus 488-conjugated BOULE Polyclonal antibody

BOULE Polyclonal Antibody for IF-P, IF-Fro

Cat No. CL488-13720

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P, IF-Fro

BOLL, Protein boule-like

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse testis tissue
Positive IF-Fro detected inmouse testis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13720 targets BOULE in IF-P, IF-Fro applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4662

Product name: Recombinant human BOLL protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-283 aa of BC033674

Sequence: MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

Predict reactive species
Full Name bol, boule-like (Drosophila)
Calculated Molecular Weight 283 aa, 31 kDa
GenBank Accession NumberBC033674
Gene Symbol BOULE
Gene ID (NCBI) 66037
RRIDAB_2919076
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N9W6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BOULE, also called BOLL, belongs to the RRM DAZ family. BOULE has been identified as being involved in regulating the development and differentiation of germ cells and playing an essential role in infertility (PMID: 31683986). BOULE is specifically expressed in testis, but not in early embryos, primordial germ cells, and spermatogonial cells. It is first expressed in the cytoplasm of spermatocytes and then persists through meiosis. BOULE has 5 isoforms with the molecular mass of 19 and 31-38 kDa. This antibody detects two bands in testis, the lower band of ~40 kDa in size corresponds to the predicted endogenous BOULE protein, while the upper band may be an isoform or posttranslationally modified version of the BOULE protein (PMID: 27632217).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 BOULE antibody CL488-13720Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...