BRWD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BRWD1 Polyclonal antibody, PBS Only (29293-1-PBS)

• 

  WB analysis using 29293-1-AP (same clone as 29293-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29293-1-AP (BRWD1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29293-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29293-1-AP (same clone as 29293-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29293-1-AP (BRWD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29293-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 29293-1-AP (same clone as 29293-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29293-1-AP (BRWD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29293-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 29293-1-AP (same clone as 29293-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29293-1-AP (BRWD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29293-1-PBS in a different storage buffer formulation.

BRWD1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29293-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Bromodomain and WD repeat-containing protein 1, C21orf107, N143, WD repeat containing protein 9, WD repeat-containing protein 9

---

Product Information

29293-1-PBS targets BRWD1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30902

  Product name: Recombinant human BRWD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-120 aa of BC064602

  Sequence: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI

• Full Name: bromodomain and WD repeat domain containing 1
• Calculated Molecular Weight: 2320 aa, 263 kDa
• Observed Molecular Weight: 263 kDa
• GenBank Accession Number: BC064602
• Gene Symbol: BRWD1
• Gene ID (NCBI): 54014
• RRID: AB_3086110
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NSI6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BRWD1 (Bromodomain and WD repeat domain containing 1, also known as WDR9) has a predicted molecular weight of 263 kDa and contains tandem BROMO domains and WD40 repeats (PMID:12889071). One of the remarkable functions of BRWD1 was the coordinated repression of MYC and MYC target genes. At the Myc/MYC locus, in both mice and humans, BRWD1 specififically repressed distal enhancers, which are associated with lineage specifific expression (PMID:30250168). In addition,BRWD1 as a key epigenomic mediator of normal neurodevelopment and an important contributor to DS (Down syndrome)-related phenotypes (PMID:36289231).