• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated BSAP,PAX5 Monoclonal antibody

BSAP,PAX5 Monoclonal Antibody for FC (Intra)
Cat No. CL594-60349
Clone No.2H2D6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF, FC (Intra)

PAX5, 2H2D6, B-cell-specific transcription factor, paired box 5, Paired box protein Pax 5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inRamos cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL594-60349 targets BSAP,PAX5 in IF, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16023

Product name: Recombinant human BSAP,PAX5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 145-391 aa of BC156927

Sequence: QPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH

Predict reactive species
Full Name paired box 5
Calculated Molecular Weight 391 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC156927
Gene Symbol PAX5
Gene ID (NCBI) 5079
RRIDAB_2934711
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ02548
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PAX5, also named B-cell specific activator protein (BSAP), is a member of the highly conserved paired box (PAX)-domain family of transcription factors. PAX5 is essential in normal B-cell lymphopoiesis. It is expressed in pro-B, pre-B and mature B lymphocytes but not in plasma cells. PAX5 is a common target in leukemogenesis of B-ALL ( B-lineage acute lymphoblastic leukemia) along with CDKN2A. Owing to its frequent deletion in B-ALL, PAX5 could be used as one of the molecular markers in diagnosis and monitoring of the disease. This antibody is specific to PAX5. It will not cross react with other PAX members.

Protocols

Product Specific Protocols
FC protocol for CL594 BSAP,PAX5 antibody CL594-60349Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IF

Mol Med

Reciprocal METTL3-PAX5 regulation in maintaining B-cell identity and promoting B-cell hyperreactivity in SLE

Authors - Yiying Yang
Loading...
||
New chat Able
正在加载,请稍候...