BTBD8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BTBD8 Polyclonal antibody, PBS Only (23897-1-PBS)

• 

  WB analysis of HEK-293 using 23897-1-AP (same clone as 23897-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 23897-1-AP (BTBD8 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23897-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 23897-1-AP (same clone as 23897-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 23897-1-AP (BTBD8 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23897-1-PBS in a different storage buffer formulation.

BTBD8 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 23897-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

23897-1-PBS targets BTBD8 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20960

  Product name: Recombinant human BTBD8 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-378 aa of BC013922

  Sequence: MARCGEGSAAPMVLLGSAGVCSKGLQRKGPCERRRLKATVSEQLSQDLLRLLREEFHTDVTFSVGCTLFKAHKAVLLARVPDFYFHTIGQTSNSLTNQEPIAVENVEALEFRTFLQIIYSSNRNIKNYEEEILRKKIMEIGISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFISNDNYDLEPASELGEDLLKLYVKPGCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVMMHFIYGGTLDIPDKTNVGQILNMADMYGLEGLKEVAIYILRRDYCNFFQKPVPRTLTSILECLIIAHSVGVESLFADCMKWIVKHFARFWSERSFANIPPEIQKSCLNMLIQSLVNIT

• Full Name: BTB (POZ) domain containing 8
• Calculated Molecular Weight: 278 aa, 43 kDa
• Observed Molecular Weight: 43 kDa, 34 kDa
• GenBank Accession Number: BC013922
• Gene Symbol: BTBD8
• Gene ID (NCBI): 284697
• RRID: AB_2879353
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9UPP5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BTBD8, also named as BTB/POZ domain-containing protein 8, is a 378 amino acid protein, which is highly expressed in fetal brain and localizes in the nucleus. BTBD8 exists two isoforms and the molecular weight of isoforms are 43 kDa and 35 kDa.