BTG3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BTG3 Polyclonal antibody, PBS Only (20336-1-PBS)

• 

  WB analysis using 20336-1-AP (same clone as 20336-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20336-1-AP (BTG3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20336-1-PBS in a different storage buffer formulation.

BTG3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20336-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

TOB5, Protein Tob5, Protein BTG3, BTG family, member 3, BTG family member 3

---

Product Information

20336-1-PBS targets BTG3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14112

  Product name: Recombinant human BTG3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 97-296 aa of BC011957

  Sequence: DPCEVCCRRDGVSPCWPDCSQTPDLVIRPPWPPKALDYRREPLRPASSFLIMYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLAPH

• Full Name: BTG family, member 3
• Calculated Molecular Weight: 296 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC011957
• Gene Symbol: BTG3
• Gene ID (NCBI): 10950
• RRID: AB_3741989
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14201
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BTG3 (B-cell translocation gene 3) is a member of the antiproliferative BTG/Tob gene family, which also includes BTG1, BTG2, BTG4, TOB, and TOB2. This gene family is characterized by similar N-terminal domains but divergent C-termini. BTG3 is considered a candidate tumor suppressor gene and plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. (PMID: 38714880)