Mouse BTLA/CD272 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84754-5-RR (same clone as 84754-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84754-5-RR (BTLA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84754-5-PBS in a different storage buffer formulation.

• 

  IF Staining of A20 using 84754-5-RR (same clone as 84754-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A20 cells using BTLA antibody (84754-5-RR, Clone: 242133E5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84754-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84754-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84754-5-RR against Mouse BTLA were performed. The affinity constant is 1.12 nM.

BTLA/CD272 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 84754-5-PBS

Clone No.242133E5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

242133E5, B- and T-lymphocyte attenuator, B- and T-lymphocyte-associated protein, Btla, CD272

---

Product Information

84754-5-PBS targets BTLA/CD272 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1843

  Product name: Recombinant Mouse BTLA protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 30-176 aa of AAI08964.1

  Sequence: EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPG

• Full Name: B and T lymphocyte associated
• Calculated Molecular Weight: 34kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: AAI08964.1
• Gene Symbol: Btla
• Gene ID (NCBI): 208154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q32MV9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BTLA, or B and T lymphocyte attenuator, is a member of the CD28 superfamily and is a type I membrane glycoprotein identified as an inhibitory receptor (PMID: 33859648). BTLA is extensively expressed in lymph nodes, thymus, and spleen, with little or no expression in organs such as the heart, kidney, brain, and liver (PMID: 33859648). Among immune cells, BTLA is primarily expressed in B and T cells, with higher expression in B cells compared to T cells in the mouse spleen (PMID: 33859648). BTLA plays a crucial role in regulating stimulatory and inhibitory signals in immune responses.