Product Information
26687-1-PBS targets BTN1A1 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24613 Product name: Recombinant human BTN1A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 448-526 aa of BC096312 Sequence: SNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP Predict reactive species |
| Full Name | butyrophilin, subfamily 1, member A1 |
| Calculated Molecular Weight | 526 aa, 59 kDa |
| Observed Molecular Weight | 65-75 kDa |
| GenBank Accession Number | BC096312 |
| Gene Symbol | BTN1A1 |
| Gene ID (NCBI) | 696 |
| RRID | AB_2880603 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13410 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
BTN1A1, also named as Butyrophilin subfamily 1 member A1, is a 526 amino acid protein, which contains 1 B30.2/SPRY domain and belongs to the immunoglobulin superfamily. BTN/MOG family. BTN1A1 localizes in the integral component of plasma membrane. BTN1A1 may function in the secretion of milk-fat droplets and may act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane. BTN1A1 Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion. The calculated molecular weight of BTN1A1 is a 59 kDa, but the modified BTN1A1 protein is about 65-75 kDa.
