BTN3A1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BTN3A1 Polyclonal antibody, PBS Only (25221-1-PBS)

• 

  WB analysis of U-937 using 25221-1-AP (same clone as 25221-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 25221-1-AP (BTN3A1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25221-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 25221-1-AP (same clone as 25221-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25221-1-AP (BTN3A1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25221-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 25221-1-AP (same clone as 25221-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using BTN3A1 antibody (25221-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25221-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BTN3A1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 25221-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

25221-1-PBS targets BTN3A1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18414

  Product name: Recombinant human BTN3A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 267-336 aa of BC121800

  Sequence: GYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKAL

• Full Name: butyrophilin, subfamily 3, member A1
• Calculated Molecular Weight: 513 aa, 58 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC121800
• Gene Symbol: BTN3A1
• Gene ID (NCBI): 11119
• RRID: AB_2879969
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00481
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BTN3A1, also named as Butyrophilin subfamily 3 member A1 or BTF5, is a 513 amino acid protein ,which contains one B30.2/SPRY domain and two Ig-like V-type (immunoglobulin-like) domains. BTN3A1 localizes in the cell membrane and belongs to the immunoglobulin superfamily. BTN/MOG family. BTN3A1 is detected on T-cells, natural killer cells, dendritic cells and macrophages. It is ubiquitously highly expressed in heart, pancreas and lung and moderately expressed in placenta, liver and muscle. BTN3A1 plays a role in T-cell activation and in the adaptive immune response. It also regulates the proliferation of activated T-cells and the release of cytokines and IFNG by activated T-cells. It exists as four isoforms. We detected a 48 kda isoform by western blot.