BTNL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BTNL2 Polyclonal antibody (25110-1-AP)

BTNL2 Polyclonal Antibody for WB, ELISA

Cat No. 25110-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

BTL II, BTNL2, Butyrophilin like protein 2, HSBLMHC1, SS2

• 

  WB analysis using 25110-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25110-1-AP (BTNL2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 25110-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 25110-1-AP (BTNL2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BTNL2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, mouse kidney tissue, HepG2 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25110-1-AP targets BTNL2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18803

  Product name: Recombinant human BTNL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-229 aa of BC127642

  Sequence: KQSEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVGLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISI

• Full Name: butyrophilin-like 2 (MHC class II associated)
• Calculated Molecular Weight: 455 aa, 50 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC127642
• Gene Symbol: BTNL2
• Gene ID (NCBI): 56244
• RRID: AB_2879902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UIR0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Butyrophilin-like protein 2 (BTNL2) is a transmembrane immunoregulatory protein that is highly expressed in the gastrointestinal tract. BTNL2 belongs to the butyrophilin-like family of proteins, and several of the butyrophilins and butyrophilin-like proteins, such as BTN2A1, BTN3A1, skint-1, BTNL1 and BTNL6, have been shown to play an essential role in regulating γδ T cell development and differentiation.

Publications

What published studies show

The anti-BTNL2 antibody (Cat# 25110-1-AP) has 2 citations. They appear in Nature Communications and Microorganisms. The cited studies span cancer immunology—specifically tumour immune escape via γδ T cell engagement—and macrophage biology, examining BTNL2's role in inhibiting pyroptosis through mitochondrial homeostasis maintenance. Both applications were Western blot in human and mouse samples, respectively.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Cancer cell-expressed BTNL2 facilitates tumour immune escape via engagement with IL-17A-producing γδ T cells.; Authors - Yanyun Du
mouse	WB	Microorganisms; BTNL2 Inhibits Pyroptosis in H37Ra-Infected Macrophages by Maintaining Mitochondrial Homeostasis.; Authors - Yazhi Feng