BUD13 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BUD13 Polyclonal antibody, PBS Only (20163-1-PBS)

• 

  IHC staining of mouse testis using 20163-1-AP (same clone as 20163-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20163-1-AP (BUD13 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20163-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 20163-1-AP (same clone as 20163-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20163-1-AP (BUD13 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20163-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 20163-1-AP (same clone as 20163-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using BUD13 antibody (20163-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20163-1-PBS in a different storage buffer formulation.

BUD13 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 20163-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

20163-1-PBS targets BUD13 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13665

  Product name: Recombinant human BUD13 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 260-619 aa of BC006350

  Sequence: DTQQLRRARHDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEYDPDISPPRKKQAKSHFGDKKQLDSKGDCQKATDSDLSSPRHKQSPGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETMAFEAEFQYAETVFRDKSGRKRNLKLERLEQRRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNKKVRPRYSGPAPPPNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM

• Full Name: BUD13 homolog (S. cerevisiae)
• Calculated Molecular Weight: 619 aa, 71 kDa
• Observed Molecular Weight: 71-85 kDa
• GenBank Accession Number: BC006350
• Gene Symbol: BUD13
• Gene ID (NCBI): 84811
• RRID: AB_2878650
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRD0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BUD13 homolog (BUD13) is a component of the retention and splicing (RES) complex, previously identified in yeast as a splicing factor affecting nuclear pre-mRNA retention. As an RNA binding protein (RBP), BUD13 expression is associated with poor prognosis and may be involved in the development and progression of hepatocellular carcinoma (PMID: 37605593).