BUD31 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BUD31 Polyclonal antibody, PBS Only (11798-1-PBS)

• 

  WB analysis of mouse brain using 11798-1-AP (same clone as 11798-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11798-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 11798-1-AP (same clone as 11798-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11798-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 11798-1-AP (same clone as 11798-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11798-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 11798-1-AP (same clone as 11798-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11798-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 11798-1-AP (same clone as 11798-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11798-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 11798-1-AP (same clone as 11798-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11798-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 11798-1-AP (same clone as 11798-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11798-1-PBS in a different storage buffer formulation.

• 

  WB analysis of hESC using 11798-1-AP (same clone as 11798-1-PBS)

  hESC cells were subjected to SDS PAGE followed by western blot with 11798-1-AP (BUD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11798-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 11798-1-AP (same clone as 11798-1-PBS)

  IP result of anti-BUD31 (IP:11798-1-AP, 4ug; Detection:11798-1-AP 1:1500) with mouse brain tissue lysate 3440ug. This data was developed using the same antibody clone with 11798-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11798-1-AP (same clone as 11798-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11798-1-AP (BUD31 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 11798-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BUD31 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11798-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

11798-1-PBS targets BUD31 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2373

  Product name: Recombinant human BUD31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-144 aa of BC022821

  Sequence: MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

• Full Name: BUD31 homolog (S. cerevisiae)
• Calculated Molecular Weight: 144 aa, 17 kDa
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC022821
• Gene Symbol: BUD31
• Gene ID (NCBI): 8896
• RRID: AB_2274894
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41223
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.