BUD31 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85336-1-RR (same clone as 85336-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85336-1-RR (BUD31 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85336-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 85336-1-RR (same clone as 85336-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85336-1-RR (BUD31 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85336-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-251 using 85336-1-RR (same clone as 85336-1-PBS)

  WB result of BUD31 antibody (85336-1-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BUD31 transfected U-251 cells. This data was developed using the same antibody clone with 85336-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 85336-1-RR (same clone as 85336-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85336-1-RR (BUD31 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85336-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 85336-1-RR (same clone as 85336-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85336-1-RR (BUD31 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85336-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85336-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85336-1-RR against Human BUD31 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

BUD31 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85336-1-PBS

Clone No.242551D3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242551D3, EDG 2, EDG2, fSAP17, G10

---

Product Information

85336-1-PBS targets BUD31 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2373

  Product name: Recombinant human BUD31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-144 aa of BC022821

  Sequence: MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

• Full Name: BUD31 homolog (S. cerevisiae)
• Calculated Molecular Weight: 144 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC022821
• Gene Symbol: BUD31
• Gene ID (NCBI): 8896
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41223
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.