BVES Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BVES Polyclonal antibody, PBS Only (12920-1-PBS)

• 

  WB analysis of mouse skeletal muscle using 12920-1-AP (same clone as 12920-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 12920-1-AP (BVES antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12920-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 12920-1-AP (same clone as 12920-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 12920-1-AP (BVES antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12920-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 12920-1-AP (same clone as 12920-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 12920-1-AP (BVES antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12920-1-PBS in a different storage buffer formulation.

BVES Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12920-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12920-1-PBS targets BVES in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3593

  Product name: Recombinant human BVES protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 112-360 aa of BC034425

  Sequence: LYKKRPVKIEKELSGMYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP

• Full Name: blood vessel epicardial substance
• Calculated Molecular Weight: 360 aa, 41 kDa
• Observed Molecular Weight: 41-70 kDa
• GenBank Accession Number: BC034425
• Gene Symbol: BVES
• Gene ID (NCBI): 11149
• RRID: AB_10640584
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NE79
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BVES, also named as POP1, POPDC1 and hBVES, belongs to the popeye family. It is cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. It is involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. It is also involved in striated muscle regeneration and repair and in the regulation of cell spreading. BVES is expressed in the progenitors of coronary artery smooth muscle cells as well as in differentiated smooth muscle cells.