• Featured Product
  • KD/KO Validated

BZW1 Polyclonal antibody

BZW1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 19917-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

5MP2, Basic leucine zipper and W2 domain-containing protein 1, BZAP45, eIF5-mimic protein 2, KIAA0005

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF7 cells, HeLa cells
Positive IHC detected inhuman testis tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, A431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19917-1-AP targets BZW1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13830

Product name: Recombinant human BZW1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 143-273 aa of BC001804

Sequence: SESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKD

Predict reactive species
Full Name basic leucine zipper and W2 domains 1
Calculated Molecular Weight 353 aa, 41 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC001804
Gene Symbol BZW1
Gene ID (NCBI) 9689
RRIDAB_10693530
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ7L1Q6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BZW1, also known as basic leucine zipper and W2 domains 1, is a member of the basic leucine zipper (bZIP) superfamily of transcription factors. It is a 45 kDa protein that contains an N-terminal bZIP domain for protein interactions and a C-terminal nucleotide (ATP or GTP) binding domain. Human BZW1 can activate transcription of the histone H4 gene and serve as a co-regulator with other transcription factors to control the cell cycle. In recent years, BZW1 has been identified as enhancing phosphorylation to promote glycolysis in pancreatic ductal adenocarcinoma. Moreover, BZW1 has been found to regulate the cell cycle in ovarian cancer, thereby promoting its progression. Additionally, BZW1 plays a crucial role in mucoepidermoid carcinoma of the salivary glands. BZW1 is also involved in the regulation of translation initiation, acting as a translational rheostat and autoregulating its own translation. It has been suggested that BZW1, as well as its paralog BZW2, is an eIF5-mimic protein. BZW1 has been shown to facilitate glycolysis and promote tumor growth in pancreatic ductal adenocarcinoma through potentiating eIF2α phosphorylation, and it may serve as a therapeutic target for patients with pancreatic cancer. In macrophages, activation of BZW1 by CEBPB promotes eIF2α phosphorylation-mediated metabolic reprogramming and endoplasmic reticulum stress. BZW1 has also been found to be associated with the Wnt/β-catenin pathway in lung adenocarcinoma, potentially influencing epithelial-mesenchymal transition (EMT) processes.

Protocols

Product Specific Protocols
WB protocol for BZW1 antibody 19917-1-APDownload protocol
IHC protocol for BZW1 antibody 19917-1-APDownload protocol
IF protocol for BZW1 antibody 19917-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Leukemia

IPO11 regulates the nuclear import of BZW1/2 and is necessary for AML cells and stem cells.

Authors - Boaz Nachmias
human,mouseWB,IHC,IF

Genomics

BZW1 as an oncogene is associated with patient prognosis and the immune microenvironment in glioma

Authors - Linyao Zhao
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...