• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated BZW1 Polyclonal antibody

BZW1 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-19917

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

5MP2, Basic leucine zipper and W2 domain-containing protein 1, BZAP45, eIF5-mimic protein 2, KIAA0005

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-19917 targets BZW1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13830

Product name: Recombinant human BZW1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 143-273 aa of BC001804

Sequence: SESERNKLAMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPANKQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKD

Predict reactive species
Full Name basic leucine zipper and W2 domains 1
Calculated Molecular Weight 353 aa, 41 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC001804
Gene Symbol BZW1
Gene ID (NCBI) 9689
RRIDAB_3672711
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ7L1Q6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BZW1, also known as basic leucine zipper and W2 domains 1, is a member of the basic leucine zipper (bZIP) superfamily of transcription factors. It is a 45 kDa protein that contains an N-terminal bZIP domain for protein interactions and a C-terminal nucleotide (ATP or GTP) binding domain. Human BZW1 can activate transcription of the histone H4 gene and serve as a co-regulator with other transcription factors to control the cell cycle. In recent years, BZW1 has been identified as enhancing phosphorylation to promote glycolysis in pancreatic ductal adenocarcinoma. Moreover, BZW1 has been found to regulate the cell cycle in ovarian cancer, thereby promoting its progression. Additionally, BZW1 plays a crucial role in mucoepidermoid carcinoma of the salivary glands. BZW1 is also involved in the regulation of translation initiation, acting as a translational rheostat and autoregulating its own translation. It has been suggested that BZW1, as well as its paralog BZW2, is an eIF5-mimic protein. BZW1 has been shown to facilitate glycolysis and promote tumor growth in pancreatic ductal adenocarcinoma through potentiating eIF2α phosphorylation, and it may serve as a therapeutic target for patients with pancreatic cancer. In macrophages, activation of BZW1 by CEBPB promotes eIF2α phosphorylation-mediated metabolic reprogramming and endoplasmic reticulum stress. BZW1 has also been found to be associated with the Wnt/β-catenin pathway in lung adenocarcinoma, potentially influencing epithelial-mesenchymal transition (EMT) processes.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 BZW1 antibody CL488-19917Download protocol
IF protocol for CL Plus 488 BZW1 antibody CL488-19917Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...