Beta ENaC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Beta ENaC Polyclonal antibody, PBS Only (14134-1-PBS)

• 

  WB analysis of PC-3 using 14134-1-AP (same clone as 14134-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 14134-1-AP (β-ENaC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14134-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 14134-1-AP (same clone as 14134-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 14134-1-AP (β-ENaC antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14134-1-AP (same clone as 14134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14134-1-AP (β-ENaC Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 14134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14134-1-AP (same clone as 14134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14134-1-AP (β-ENaC Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 14134-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Beta ENaC Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14134-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14134-1-PBS targets Beta ENaC in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5348

  Product name: Recombinant human β-ENaC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 68-401 aa of BC036352

  Sequence: GIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNC

• Full Name: sodium channel, nonvoltage-gated 1, beta
• Calculated Molecular Weight: 640 aa, 73 kDa
• Observed Molecular Weight: 75-80 kDa
• GenBank Accession Number: BC036352
• Gene Symbol: Beta ENaC
• Gene ID (NCBI): 6338
• RRID: AB_2184378
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51168
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SCNN1B, also named as SCNEB, ENaCB, Beta-NaCH and Beta-ENaC, belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family and SCNN1B subfamily. Sodium permeable non-voltage-sensitive ion channel is inhibited by the diuretic amiloride. SCNN1B mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. It controls the reabsorption of sodium in kidney, colon, lung and sweat glands. SCNN1B plays a role in taste perception.