Beta TRCP Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of MCF-7 using 84297-1-RR (same clone as 84297-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Beta TrCP antibody (84297-1-RR, Clone: 241287B8 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84297-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84297-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84297-1-RR against Human Beta TrCP were performed. The affinity constant is 2.81 nM.

Beta TRCP Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 84297-1-PBS

Clone No.241287B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

BTRC, 241287B8, Epididymis tissue protein Li 2a, F-box and WD repeats protein beta-TrCP, F-box/WD repeat-containing protein 1A

---

Product Information

84297-1-PBS targets Beta TRCP in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28739

  Product name: Recombinant human BETA-TRCP,BTRC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 308-605 aa of BC027994

  Sequence: CLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR

• Full Name: beta-transducin repeat containing
• Calculated Molecular Weight: 605 aa, 69 kDa
• GenBank Accession Number: BC027994
• Gene Symbol: Beta TRCP
• Gene ID (NCBI): 8945
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9Y297
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.