PYROXD2 Recombinant monoclonal antibody, PBS Only (Detector)

PYROXD2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83954-1-PBS
Clone No.240984A12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

C10orf33, YueF, FP3420, 240984A12

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83954-1-PBS targets PYROXD2 as part of a matched antibody pair:

MP00905-1: 83954-2-PBS capture and 83954-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14701

Product name: Recombinant human C10orf33 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 232-581 aa of BC006131

Sequence: DQWFESEPLKATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATTHGASIFTEKTVAKVQVNSEGCVQGVVLEDGTEVRSKMVLSNTSPQITFLKLTPQEWLPEEFLERISQLDTRSPVTKINVAVDRLPSFLAAPNAPRGQPLPHHQCSIHLNCEDTLLLHQAFEDAMDGLSSHRPVIELCIPSSLDPTLAPPGCHVVSLFTQYTPYTLAGGKAWDEQERDAYADRVFDCIEVYAPGFKDSVVGRDILTPPDLERIFGLPGGNIFHCAMSLDQLYFARPVPLHSGYRCPLQGLYLCGSGAHPGGGVMGAAGRNAAHVAFRDLKSM

Predict reactive species
Full Name chromosome 10 open reading frame 33
Calculated Molecular Weight 581 aa, 63 kDa
Observed Molecular Weight63 kDa
GenBank Accession NumberBC006131
Gene Symbol PYROXD2
Gene ID (NCBI) 84795
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N2H3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Pyridine Nucleotide-Disulfide Oxidoreductase Domain 2 (PYROXD2, previously called YueF, C10orf33) is a mitochondrial inner membrane/matrix-residing protein and is reported to regulate mitochondrial function. PYROXD2 is highly expressed in the cytoplasm of normal cells and tissues but is expressed at lower levels in corresponding cancer cells, including liver, lung and renal cell carcinoma and bladder cancer cells (PMID: 29048625, PMID: 35606887).

Loading...
||
New chat Able
正在加载,请稍候...