PYROXD2 Recombinant monoclonal antibody

• 

  WB analysis using 83954-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83954-1-RR (PYROXD2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 83954-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83954-1-RR (PYROXD2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 83954-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83954-1-RR against Human PYROXD2 were performed. The affinity constant is below 1 pM.

PYROXD2 Recombinant Antibody for WB, ELISA

Cat No. 83954-1-RR

Clone No.240984A12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C10orf33, YueF, FP3420, 240984A12

---

Tested Applications

• Positive WB detected in: HEK-293T cells, LNCaP cells, U-251 cells, A375 cells, L02 cells, Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83954-1-RR targets PYROXD2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14701

  Product name: Recombinant human C10orf33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 232-581 aa of BC006131

  Sequence: DQWFESEPLKATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATTHGASIFTEKTVAKVQVNSEGCVQGVVLEDGTEVRSKMVLSNTSPQITFLKLTPQEWLPEEFLERISQLDTRSPVTKINVAVDRLPSFLAAPNAPRGQPLPHHQCSIHLNCEDTLLLHQAFEDAMDGLSSHRPVIELCIPSSLDPTLAPPGCHVVSLFTQYTPYTLAGGKAWDEQERDAYADRVFDCIEVYAPGFKDSVVGRDILTPPDLERIFGLPGGNIFHCAMSLDQLYFARPVPLHSGYRCPLQGLYLCGSGAHPGGGVMGAAGRNAAHVAFRDLKSM

• Full Name: chromosome 10 open reading frame 33
• Calculated Molecular Weight: 581 aa, 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC006131
• Gene Symbol: PYROXD2
• Gene ID (NCBI): 84795
• RRID: AB_3671533
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N2H3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pyridine Nucleotide-Disulfide Oxidoreductase Domain 2 (PYROXD2, previously called YueF, C10orf33) is a mitochondrial inner membrane/matrix-residing protein and is reported to regulate mitochondrial function. PYROXD2 is highly expressed in the cytoplasm of normal cells and tissues but is expressed at lower levels in corresponding cancer cells, including liver, lung and renal cell carcinoma and bladder cancer cells (PMID: 29048625, PMID: 35606887).