C11orf70 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C11orf70 Polyclonal antibody, PBS Only (20780-1-PBS)

• 

  WB analysis of mouse testis using 20780-1-AP (same clone as 20780-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 20780-1-AP (C11orf70 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20780-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 20780-1-AP (same clone as 20780-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 20780-1-AP (C11orf70 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20780-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20780-1-AP (same clone as 20780-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 20780-1-AP (C11orf70 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20780-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20780-1-AP (same clone as 20780-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 20780-1-AP (C11orf70 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20780-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 20780-1-AP (same clone as 20780-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 20780-1-AP (C11orf70 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20780-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 20780-1-AP (same clone as 20780-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 20780-1-AP (C11orf70 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20780-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 20780-1-AP (same clone as 20780-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using C11orf70 antibody (20780-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 20780-1-PBS in a different storage buffer formulation.

C11orf70 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20780-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CFAP300, Cilia- and flagella-associated protein 300, CK070

---

Product Information

20780-1-PBS targets C11orf70 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14793

  Product name: Recombinant human C11orf70 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-229 aa of BC006128

  Sequence: MLGRIKAQAFGFDQTFQSYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWIILGTEVKKIEAINVPCTQLSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETTKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS

• Full Name: chromosome 11 open reading frame 70
• Calculated Molecular Weight: 267 aa, 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC006128
• Gene Symbol: C11orf70
• Gene ID (NCBI): 85016
• RRID: AB_10755147
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRQ4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The CFAP300 protein is an important member of the cilia- and flagella-associated protein family, localized in the basal body and axoneme structures of cellular cilia. It plays a central role in ciliary assembly and stability, primarily by participating in the transport and anchoring of pre-assembled complexes within the cytoplasm. Research indicates that mutations in the CFAP300 gene lead to structural and functional defects in cilia, which are closely associated with various human ciliopathies, such as primary ciliary dyskinesia, heterotaxy, and male infertility. Loss of its function disrupts intraflagellar transport, affecting key physiological processes including left-right axis determination during embryonic development and mucociliary clearance in the respiratory tract. Therefore, CFAP300 is a crucial protein molecule for understanding ciliary biology and the mechanisms of related diseases.