DDIAS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DDIAS Polyclonal antibody, PBS Only (27754-1-PBS)

• 

  WB analysis using 27754-1-AP (same clone as 27754-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27754-1-AP (C11orf82 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27754-1-PBS in a different storage buffer formulation.

DDIAS Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27754-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C11orf82, DNA Damage Induced Apoptosis Suppressor, DNA damage-induced apoptosis suppressor protein, Nitric oxide-inducible gene protein, noxin

---

Product Information

27754-1-PBS targets DDIAS in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26829

  Product name: Recombinant human C11orf82 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-170 aa of BC039268

  Sequence: IYPSCQKCFSRIILVSKRSNCPKCGSTGESGNANYRYKLSLKVAESNKLFVITVFGSCLDTFFGLTATGLHRYIQDPNKIPETLDNDTTQNLLTKAVETCFVGQSFIFGVTNFENQPGQGSDASNFLQQCSDHKRKAKALVACQIVLPDP

• Full Name: chromosome 11 open reading frame 82
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC039268
• Gene Symbol: C11orf82
• Gene ID (NCBI): 220042
• RRID: AB_3669620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IXT1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DNA damage-induced apoptosis suppressor (DDIAS) is an oncogenic protein that is highly expressed in several cancers, including colorectal, lung, breast, and hepatocellular carcinoma (HCC), and stimulates cancer cell proliferation and cell cycle progression.DDIAS protects cancer cells from DNA damage reagents and tumor necrosis factor-associated apoptosis-inducing ligands (TRAILs) and positively regulates cancer cell invasion by stabilizing the β- catenin positively regulates cancer cell invasion. Therefore, DDIAS is considered as a potential therapeutic target for malignant lung cancer.