C12orf29 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C12orf29 Polyclonal antibody, PBS Only (31647-1-PBS)

• 

  WB analysis using 31647-1-AP (same clone as 31647-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31647-1-AP (C12orf29 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31647-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 31647-1-AP (same clone as 31647-1-PBS)

  WB result of C12orf29 antibody (31647-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C12orf29 transfected HeLa cells. This data was developed using the same antibody clone with 31647-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 31647-1-AP (same clone as 31647-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 31647-1-AP (C12orf29 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31647-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 31647-1-AP (same clone as 31647-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 31647-1-AP (C12orf29 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31647-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 31647-1-AP (same clone as 31647-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using C12orf29 antibody (31647-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 31647-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

C12orf29 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31647-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

RNA Ligase, RNA Ligase 1, Rnl

---

Product Information

31647-1-PBS targets C12orf29 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35681

  Product name: Recombinant human C12orf29 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of NM_001009894.2

  Sequence: MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDGTCCYVTTYKDQPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIPAKETEQINGNPVPDENGHIPGWVPVEKNNK

• Full Name: chromosome 12 open reading frame 29
• Calculated Molecular Weight: 37kDa，325aa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: NM_001009894.2
• Gene Symbol: C12orf29
• Gene ID (NCBI): 91298
• RRID: AB_3670063
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N999
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C12orf29, also known as RLIG1, is a 37 kDa human protein consisting of 325 amino acids. It catalyzes ATP-dependent RNA ligation via a three-step mechanism involving tandem auto- and RNA AMPylation (PMID: 36792600).