• Featured Product
  • KD/KO Validated

C12orf30 Polyclonal antibody

C12orf30 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 31748-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

MDM20, NAA25, N-alpha-acetyltransferase 25, NatB auxiliary subunit, NAP1, N-terminal acetyltransferase B complex subunit MDM20

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, Calu-1 cells
Positive IP detected inmouse ovary tissue, HeLa cells
Positive IHC detected inhuman colon cancer tissue, human cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31748-1-AP targets C12orf30 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag36383

Product name: Recombinant human C12orf30 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 703-972 aa of BC113585

Sequence: LNHPVEPKNSEKTAENGVSSRIDILRLLLQQLEATLETGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLLEVKDGNLKTHPTLLENLVFFVETISVILWVSSYCESVLRPYKLNLQKKKKKKKETSIIMPPVFTSFQDYVTGLQTLISNVVDHIKGLETHLIALKLEELILEDTSLSPEERKFSKTVQGKVQSSYLHSLLEMGELLKKRLETTKKLKI

Predict reactive species
Full Name chromosome 12 open reading frame 30
Observed Molecular Weight113 kDa,140 kDa
GenBank Accession NumberBC113585
Gene Symbol C12orf30
Gene ID (NCBI) 80018
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ14CX7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The C12orf30 gene encodes an auxiliary subunit of the N-terminal acetyltransferase B (NatB) complex, which is responsible for the acetylation of methionine residues at the N-terminus of proteins. The C12orf30 protein plays a role in the distribution and morphology of organelles, and is involved in cell migration and the dynamic changes of the cytoskeleton. In addition, polymorphisms in the C12orf30 gene are associated with susceptibility to various autoimmune diseases, such as rheumatoid arthritis, juvenile idiopathic arthritis, and type 1 diabetes. The C12orf30 protein also participates in regulating the function of immune cells, influencing their signal transduction. The theoretical size of C12orf30 protein is 113 kDa, and it is possible that post-translational modifications may have shifted the protein band up to about 140 kD.

Protocols

Product Specific Protocols
IF protocol for C12orf30 antibody 31748-1-APDownload protocol
IHC protocol for C12orf30 antibody 31748-1-APDownload protocol
IP protocol for C12orf30 antibody 31748-1-APDownload protocol
WB protocol for C12orf30 antibody 31748-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...