C12orf30 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C12orf30 Polyclonal antibody, PBS Only (31748-1-PBS)

• 

  WB analysis of HeLa using 31748-1-AP (same clone as 31748-1-PBS)

  WB result of C12orf30 antibody (31748-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C12orf30 transfected HeLa cells. This data was developed using the same antibody clone with 31748-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31748-1-AP (same clone as 31748-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31748-1-AP (C12orf30 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31748-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 31748-1-AP (same clone as 31748-1-PBS)

  IP result of anti-C12orf30 (IP:31748-1-AP, 4ug; Detection:31748-1-AP 1:2000) with HeLa cells lysate 1280 ug. This data was developed using the same antibody clone with 31748-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse ovary using 31748-1-AP (same clone as 31748-1-PBS)

  IP result of anti-C12orf30 (IP:31748-1-AP, 4ug; Detection:31748-1-AP 1:1500) with mouse ovary tissue lysate 640 ug. This data was developed using the same antibody clone with 31748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 31748-1-AP (same clone as 31748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 31748-1-AP (C12orf30 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31748-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 31748-1-AP (same clone as 31748-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 31748-1-AP (C12orf30 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31748-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 31748-1-AP (same clone as 31748-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using C12orf30 antibody (31748-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 31748-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

C12orf30 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 31748-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

MDM20, NAA25, N-alpha-acetyltransferase 25, NatB auxiliary subunit, NAP1, N-terminal acetyltransferase B complex subunit MDM20

---

Product Information

31748-1-PBS targets C12orf30 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36383

  Product name: Recombinant human C12orf30 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 703-972 aa of BC113585

  Sequence: LNHPVEPKNSEKTAENGVSSRIDILRLLLQQLEATLETGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLLEVKDGNLKTHPTLLENLVFFVETISVILWVSSYCESVLRPYKLNLQKKKKKKKETSIIMPPVFTSFQDYVTGLQTLISNVVDHIKGLETHLIALKLEELILEDTSLSPEERKFSKTVQGKVQSSYLHSLLEMGELLKKRLETTKKLKI

• Full Name: chromosome 12 open reading frame 30
• Observed Molecular Weight: 113 kDa，140 kDa
• GenBank Accession Number: BC113585
• Gene Symbol: C12orf30
• Gene ID (NCBI): 80018
• RRID: AB_3742472
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q14CX7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The C12orf30 gene encodes an auxiliary subunit of the N-terminal acetyltransferase B (NatB) complex, which is responsible for the acetylation of methionine residues at the N-terminus of proteins. The C12orf30 protein plays a role in the distribution and morphology of organelles, and is involved in cell migration and the dynamic changes of the cytoskeleton. In addition, polymorphisms in the C12orf30 gene are associated with susceptibility to various autoimmune diseases, such as rheumatoid arthritis, juvenile idiopathic arthritis, and type 1 diabetes. The C12orf30 protein also participates in regulating the function of immune cells, influencing their signal transduction. The theoretical size of C12orf30 protein is 113 kDa, and it is possible that post-translational modifications may have shifted the protein band up to about 140 kD.