Home
Products
Primary Antibodies
MTRFR Polyclonal antibody, PBS Only (24646-1-PBS)

Filter: AllIHC

IHC staining of human kidney using 24646-1-AP (same clone as 24646-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24646-1-AP (C12orf65 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24646-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 24646-1-AP (same clone as 24646-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24646-1-AP (C12orf65 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24646-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 24646-1-AP (same clone as 24646-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 24646-1-AP (MTRFR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24646-1-PBS in a different storage buffer formulation.

MTRFR Polyclonal antibody, PBS Only

MTRFR Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 24646-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

C12orf65, Mitochondrial translation release factor in rescue, My030

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

24646-1-PBS targets MTRFR in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag19965 Product name: Recombinant human C12orf65 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 11-94 aa of BC062329 Sequence: TPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVK Predict reactive species
Full Name	Mitochondrial translation release factor in rescue
Calculated Molecular Weight	166 aa, 19 kDa
GenBank Accession Number	BC062329
Gene Symbol	MTRFR
Gene ID (NCBI)	91574
RRID	AB_2879653
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H3J6
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

C12orf65 participates in the process of mitochondrial translation and has been shown to be associated with a spectrum of phenotypes, including early onset optic atrophy, progressive encephalomyopathy, peripheral neuropathy, and spastic paraparesis.