C13orf1 Polyclonal antibody

• 

  WB analysis of mouse brain using 26510-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26510-1-AP (C13orf1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lymphoma using 26510-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 26510-1-AP (C13orf1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 26510-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 26510-1-AP (C13orf1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-12 using 26510-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-12 cells using C13orf1 antibody (26510-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

C13orf1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26510-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SPRYD7, SPRY7, SPRY domain-containing protein 7, CLLD6

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

26510-1-AP targets C13orf1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23487

  Product name: Recombinant human C13orf1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-157 aa of BC022519

  Sequence: MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYDDDSAILDCQFSEFYHTPPPGFEKILFEQQIF

• Full Name: chromosome 13 open reading frame 1
• Observed Molecular Weight: 17 kDa, 20 kDa
• GenBank Accession Number: BC022519
• Gene Symbol: C13orf1
• Gene ID (NCBI): 57213
• RRID: AB_2880536
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5W111
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C13orf1, also named as SPRYD7 and CLLD6, is involved in hematopoiesis via NOTCH signaling. C13orf1 plays an important role in the pathogenesis of B-CLL. There're some isoforms of C13orf1 with MW 15-17 kDa and 19-22 kDa.3

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Mouse	WB	Nat Commun; Cxcr4 regulates a pool of adipocyte progenitors and contributes to adiposity in a sex-dependent manner; Authors - Benjamin M Steiner