C14orf126 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C14orf126 Polyclonal antibody, PBS Only (23923-1-PBS)

• 

  WB analysis using 23923-1-AP (same clone as 23923-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23923-1-AP (C14orf126 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23923-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 23923-1-AP (same clone as 23923-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23923-1-AP (C14orf126 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23923-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 23923-1-AP (same clone as 23923-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 23923-1-AP (C14orf126 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23923-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 23923-1-AP (same clone as 23923-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using C14orf126 antibody (23923-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 23923-1-PBS in a different storage buffer formulation.

C14orf126 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 23923-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Animalia-specific tRNA deacylase, ATD, D-aminoacyl-tRNA deacylase 2, DTD2, D-tyrosyl-tRNA(Tyr) deacylase 2

---

Product Information

23923-1-PBS targets C14orf126 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21053

  Product name: Recombinant human C14orf126 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-168 aa of BC010618

  Sequence: MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF

• Full Name: chromosome 14 open reading frame 126
• Calculated Molecular Weight: 168 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC010618
• Gene Symbol: C14orf126
• Gene ID (NCBI): 112487
• RRID: AB_3669426
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96FN9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C14orf126, also named D-aminoacyl-tRNA deacylase 2 (DTD2), can deacylate L-Ala due to a relaxed specificity for substrate chirality caused by the trans conformation of the Gly-Pro motif in the active site. Plants are unique in possessing two distinct chiral proofreading systems, D-aminoacyl-tRNA deacylase1 (DTD1) and DTD2, of bacterial and archaeal origins, respectively.