C14orf166 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C14orf166 Polyclonal antibody (19848-1-AP)

• Featured Product
• KD/KO Validated

C14orf166 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 19848-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

RTRAF, CLE7 homolog, CLE7, CLE, CGI-99

• 

  WB analysis using 19848-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19848-1-AP (C14orf166 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 19848-1-AP

  WB result of C14orf166 antibody (19848-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C14orf166 transfected A549 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse pancreas using 19848-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 19848-1-AP (C14orf166 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 19848-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 19848-1-AP (C14orf166 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 19848-1-AP

  IP result of anti-C14orf166 (IP:19848-1-AP, 3ug; Detection:19848-1-AP 1:700) with Jurkat cells lysate 1080ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 19848-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 19848-1-AP (C14orf166 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 19848-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 19848-1-AP (C14orf166 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 19848-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 19848-1-AP (C14orf166 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 19848-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 19848-1-AP (C14orf166 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Jurkat using 19848-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using C14orf166 antibody (19848-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C14orf166 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, mouse pancreas tissue, mouse lung tissue, Jurkat cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19848-1-AP targets C14orf166 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13900

  Product name: Recombinant human CLE; C14orf166 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-244 aa of BC001722

  Sequence: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

• Full Name: chromosome 14 open reading frame 166
• Calculated Molecular Weight: 244 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC001722
• Gene Symbol: C14orf166
• Gene ID (NCBI): 51637
• RRID: AB_10646485
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y224
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human CLE/C14orf166 protein is a positive modulator of cellular RNA polymerase. CLE is also shown to interact with the influenza virus polymerase complex and colocalizes with viral ribonucleoproteins, and is required for viral replication. Similarly, CLE is identified as a novel host interacting partners of the mature hepatitis C virus core protein. CLE levels were significantly higher in the serum of patients with PaCa compared with the control group was strongly expressed in tumor cells, suggesting that C14orf166 may be a potential biomarker of pancreatic adenocarcinoma.

Publications

What published studies show

The antibody (Cat# 19848-1-AP) has 9 total citations published in journals including Redox Biology, Nucleic Acids Research, Advanced Science, Journal of Translational Medicine, Communications Biology, Molecular Medicine Reports, Bioscience Reports, and Tumour Biology. Research fields span RNA processing and translation, redox homeostasis, and oncology (breast, esophageal, lung, nasopharyngeal, and cervical cancers), with applications primarily in WB and IF.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB,IF	Redox Biol; ER-tethered RNA-binding protein controls NADPH oxidase translation for hydrogen peroxide homeostasis; Authors - Xintong Pei ; KD Validated
mouse	WB	Nucleic Acids Res; A novel all-in-one conditional knockout system uncovered an essential role of DDX1 in ribosomal RNA processing.; Authors - Teruhiko Suzuki
	WB,IF	Adv Sci (Weinh); Primate-Specific DAZ Regulates Translation of Cell Proliferation-Related mRNAs and is Essential for Maintenance of Spermatogonia; Authors - Ningjing Ou
human	WB,IHC	J Transl Med; C14orf166 overexpression correlates with tumor progression and poor prognosis of breast cancer.; Authors - Tuck-Yun Cheang ; KD Validated
human	WB	Commun Biol; DDX1 is required for non-spliceosomal splicing of tRNAs but not of XBP1 mRNA; Authors - Teruhiko Suzuki
human	WB	Mol Med Rep; Expression and clinical significance of C14orf166 in esophageal squamous cell carcinoma.; Authors - Yan-Wu Zhou