C14orf166 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C14orf166 Polyclonal antibody, PBS Only (19848-1-PBS)

• 

  WB analysis using 19848-1-AP (same clone as 19848-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19848-1-AP (C14orf166 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19848-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 19848-1-AP (same clone as 19848-1-PBS)

  WB result of C14orf166 antibody (19848-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C14orf166 transfected A549 cells. This data was developed using the same antibody clone with 19848-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 19848-1-AP (same clone as 19848-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 19848-1-AP (C14orf166 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19848-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 19848-1-AP (same clone as 19848-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 19848-1-AP (C14orf166 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19848-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 19848-1-AP (same clone as 19848-1-PBS)

  IP result of anti-C14orf166 (IP:19848-1-AP, 3ug; Detection:19848-1-AP 1:700) with Jurkat cells lysate 1080ug. This data was developed using the same antibody clone with 19848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 19848-1-AP (same clone as 19848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 19848-1-AP (C14orf166 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 19848-1-AP (same clone as 19848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 19848-1-AP (C14orf166 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 19848-1-AP (same clone as 19848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 19848-1-AP (C14orf166 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 19848-1-AP (same clone as 19848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 19848-1-AP (C14orf166 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19848-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 19848-1-AP (same clone as 19848-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using C14orf166 antibody (19848-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 19848-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

C14orf166 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 19848-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

19848-1-PBS targets C14orf166 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13900

  Product name: Recombinant human CLE; C14orf166 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-244 aa of BC001722

  Sequence: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

• Full Name: chromosome 14 open reading frame 166
• Calculated Molecular Weight: 244 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC001722
• Gene Symbol: C14orf166
• Gene ID (NCBI): 51637
• RRID: AB_10646485
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y224
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human CLE/C14orf166 protein is a positive modulator of cellular RNA polymerase. CLE is also shown to interact with the influenza virus polymerase complex and colocalizes with viral ribonucleoproteins, and is required for viral replication. Similarly, CLE is identified as a novel host interacting partners of the mature hepatitis C virus core protein. CLE levels were significantly higher in the serum of patients with PaCa compared with the control group was strongly expressed in tumor cells, suggesting that C14orf166 may be a potential biomarker of pancreatic adenocarcinoma.