EXOC3L4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EXOC3L4 Polyclonal antibody, PBS Only (32933-1-PBS)

EXOC3L4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32933-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

C14orf73, Exocyst complex component 3-like protein 4

• 

  WB analysis using 32933-1-AP (same clone as 32933-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32933-1-AP (C14orf73 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32933-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EXOC3L4 in ?

Chat with Able

---

Product Information

32933-1-PBS targets EXOC3L4 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35995

  Product name: Recombinant human C14orf73 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-255 aa of BC113655

  Sequence: MPSPQTDTPGPELQSPKEAEEPQTPAQGSRRTSSRKEPNAHRKDGTRLGLGSLRQAFSRASQRALTQVSKEDTGLFWRSSCSLFRSFRQALNEGPATGHSQATPEVPSGVMNGVSQQASTGAASEELKPEAEGKSVADLITERQLLAAFEQLLRLETLLVAEKASRTFEQDPTAFARRAMDVCLHYDGLAAEIGAIVRETLDSDGVDAAALAELARVVSAEEEAHPSPPDDGDFLRTPRRWRQHWEEAVRRSAQE

• Full Name: chromosome 14 open reading frame 73
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC113655
• Gene Symbol: C14orf73
• Gene ID (NCBI): 91828
• RRID: AB_3742795
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q17RC7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C14orf73 (chromosome 14 open reading frame 73), also known as EXOC3L4 or SEC6-like protein C14orf73, is a protein composed of 722 amino acids and belongs to the SEC6 family. This protein is a component of the exocyst complex, which plays an important role in the cellular secretion process, participating in vesicle targeting and fusion. The C14orf73 protein is predicted to have SNARE binding activity, involved in the localization of the exocyst complex and exocytosis. Additionally, rare variants in the splicing regulatory elements of this gene are associated with Alzheimer's disease.