EMC7/C15orf24 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EMC7/C15orf24 Polyclonal antibody (27550-1-AP)

EMC7/C15orf24 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27550-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

Synonyms

C15orf24, EMC7, C11orf3, Endoplasmic reticulum membrane protein complex subunit 7, HT022

• 

  WB analysis using 27550-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27550-1-AP (C15orf24 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 27550-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 27550-1-AP (EMC7/C15orf24 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 27550-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27550-1-AP (EMC7/C15orf24 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EMC7/C15orf24 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27550-1-AP targets EMC7/C15orf24 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26784

  Product name: Recombinant human C15orf24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-159 aa of BC104934

  Sequence: SEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD

• Full Name: chromosome 15 open reading frame 24
• Observed Molecular Weight: 20-26 kDa
• GenBank Accession Number: BC104934
• Gene Symbol: EMC7
• Gene ID (NCBI): 56851
• RRID: AB_2880902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPA0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian ER membrane complex (EMC) is composed of 10 subunits, EMC 1-10. Endoplasmic reticulum membrane protein complex subunit 7(EMC7, also named C15orf24) is part of the endoplasmic reticulum membrane protein complex (EMC) that enables theenergy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins.

Publications

What published studies show

The EMC7/C15orf24 Polyclonal antibody (Cat# 27550-1-AP) has 7 total citations. These appear in Nature Communications, Molecular Cell, Nature Structural & Molecular Biology, Journal of Cell Biology, eLife, and bioRxiv. The cited research spans endoplasmic reticulum membrane protein biogenesis, the EMC insertase complex, membrane protein insertion mechanisms, ERAD, calcium homeostasis, and cancer cell death.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; A small molecule VDAC ligand inhibits ERAD and induces selective cancer cell death via disruption of calcium homeostasis.; Authors - Wenjing Yan
human	WB,IP	Mol Cell; Role of a holo-insertase complex in the biogenesis of biophysically diverse ER membrane proteins.; Authors - Katharine R. Page ; KD Validated
	WB	Nat Struct Mol Biol; Structural basis of an endoplasmic reticulum EMC:Spf1 insertase-dislocase complex; Authors - Carolin J Klose
human	WB	J Cell Biol; A selectivity filter in the ER membrane protein complex limits protein misinsertion at the ER; Authors - Tino Pleiner
human	WB	Elife; The architecture of EMC reveals a path for membrane protein insertion.; Authors - John P O'Donnell
human	WB	bioRxiv; Role of a holo-insertase complex in the biogenesis of biophysically diverse ER membrane proteins; Authors - Katharine R Page