C15orf61 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C15orf61 Polyclonal antibody, PBS Only (33959-1-PBS)

• 

  WB analysis using 33959-1-AP (same clone as 33959-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33959-1-AP (C15orf61 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33959-1-PBS in a different storage buffer formulation.

C15orf61 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33959-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Uncharacterized protein C15orf61

---

Product Information

33959-1-PBS targets C15orf61 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38734

  Product name: Recombinant human C15orf61 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-157 aa of NM_001143936

  Sequence: MRPKPSASEVLTRHLLQRRLPHWTSFCVPYSAVRNDQFGLSHFNWPVQGANYHVLRTGCFPFIKYHCSKAPWQDLARQNRFFTALKVVNLGIPTLLYGLGSWLFARVTETVHTSYGPITVYFLNKEDEGAMY

• Full Name: chromosome 15 open reading frame 61
• Calculated Molecular Weight: 18 aa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: NM_001143936
• Gene Symbol: C15orf61
• Gene ID (NCBI): 145853
• RRID: AB_3743124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A6NNL5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.