C16orf14 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C16orf14 Polyclonal antibody, PBS Only (20808-1-PBS)

• 

  WB analysis using 20808-1-AP (same clone as 20808-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20808-1-AP (C16orf14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20808-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skin using 20808-1-AP (same clone as 20808-1-PBS)

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 20808-1-AP (C16orf14 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20808-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skin using 20808-1-AP (same clone as 20808-1-PBS)

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 20808-1-AP (C16orf14 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20808-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 20808-1-AP (same clone as 20808-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 20808-1-AP (C16orf14 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20808-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 20808-1-AP (same clone as 20808-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 20808-1-AP (C16orf14 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20808-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 20808-1-AP (same clone as 20808-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using C16orf14 antibody (20808-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 20808-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 20808-1-AP (same clone as 20808-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using C16orf14 antibody 20808-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 20808-1-PBS in a different storage buffer formulation.

C16orf14 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20808-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

c349E10.1, FAM195A, MAPK regulated corepressor interacting protein 2, MCRIP2, Protein FAM195A

---

Product Information

20808-1-PBS targets C16orf14 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14754

  Product name: Recombinant human C16orf14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-75 aa of BC007346

  Sequence: MYTITKGPSKLVAQRRTGPTQQQVEGRLGELLKCRQPAPPTSQPPRAQPFAQPPGPWPLSSLAAGATAAGWWPSR

• Full Name: chromosome 16 open reading frame 14
• Calculated Molecular Weight: 160 aa, 18 kDa
• Observed Molecular Weight: 8 kDa, 18 kDa
• GenBank Accession Number: BC007346
• Gene Symbol: C16orf14
• Gene ID (NCBI): 84331
• RRID: AB_10700013
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUT9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.