C17orf64 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C17orf64 Polyclonal antibody, PBS Only (25706-1-PBS)

• 

  WB analysis using 25706-1-AP (same clone as 25706-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25706-1-AP (C17orf64 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25706-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 25706-1-AP (same clone as 25706-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 25706-1-AP (C17orf64 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25706-1-PBS in a different storage buffer formulation.

C17orf64 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25706-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

CHCT1, CHD1 Helical C-Terminal Domain Containing 1, CHD1 helical C-terminal domain containing protein 1

---

Product Information

25706-1-PBS targets C17orf64 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22769

  Product name: Recombinant human C17orf64 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-126 aa of BC048806

  Sequence: MLWRFISLFSELEAKQLRRLYKYTKSSQPAKFLVTFCASDAPERSLLADREDSLPKLCHAWGLHSNISGMKERLSNMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETEP

• Full Name: chromosome 17 open reading frame 64
• Calculated Molecular Weight: 236 aa, 27 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC048806
• Gene Symbol: C17orf64
• Gene ID (NCBI): 124773
• RRID: AB_3669495
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86WR6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHCT1 (CHD1 helical C-terminal domain-containing protein 1), also called C17orf64, may play a role in the regulation of apoptosis.