MTNAP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MTNAP1 Polyclonal antibody, PBS Only (27762-1-PBS)

• 

  WB analysis of HEK-293 using 27762-1-AP (same clone as 27762-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 27762-1-AP (C17orf80 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27762-1-PBS in a different storage buffer formulation.

MTNAP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27762-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C17orf80, Cell migration-inducing gene 3 protein, HLC 8, HLC-8, MIG3

---

Product Information

27762-1-PBS targets MTNAP1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26903

  Product name: Recombinant human C17orf80 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 35-261 aa of BC005005

  Sequence: IPTDQKVYQSKPATLPRAKKMKGPIKDLIKAKGKELETENEERNSKLVVDKPEQTVKTFPLPAVGLERAATTKADKDIKNPIQPSFKMLKNTKPMTTFQEETKAQFYASEKTSPKRELAKDLPKSGESRCNPSEAGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGDLKLDKIDPQRQELLVKLLDVPTGDCHISPKNVSDGVKRVRTLLSNERDSKGRDHLSGV

• Full Name: chromosome 17 open reading frame 80
• Calculated Molecular Weight: 609 aa, 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC005005
• Gene Symbol: C17orf80
• Gene ID (NCBI): 55028
• RRID: AB_2880964
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BSJ5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.