C18orf24 Polyclonal antibody

• 

  WB analysis using 31161-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31161-1-AP (C18orf24 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

C18orf24 Polyclonal Antibody for WB, ELISA

Cat No. 31161-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

C18orf24, Ska1

---

Tested Applications

• Positive WB detected in: HeLa cells, HuH-7 cells, U2OS cells, mouse pancreas tissue, rat pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31161-1-AP targets C18orf24 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34772

  Product name: Recombinant human C18orf24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-255 aa of BC015706

  Sequence: MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT

• Full Name: chromosome 18 open reading frame 24
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC015706
• Gene Symbol: C18orf24
• Gene ID (NCBI): 220134
• RRID: AB_3669875
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96BD8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C18orf24(Spindle and kinetochore-associated protein 1, SKA1) is involved in chromosome congression and mitosis. It is upregulated and oncogenic in several human cancers (PMID: 31827398). In the human genome, SKA1, SKA2, and SKA3 constitute the SKA complex; this is necessary to maintain spindle microtubule attachment to kinetochores during mitosis (PMID: 36397719).