C19orf50 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C19orf50 Polyclonal antibody, PBS Only (20492-1-PBS)

• 

  WB analysis using 20492-1-AP (same clone as 20492-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20492-1-AP (C19orf50 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20492-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 20492-1-AP (same clone as 20492-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 20492-1-AP (C19orf50 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20492-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 20492-1-AP (same clone as 20492-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 20492-1-AP (C19orf50 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20492-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 20492-1-AP (same clone as 20492-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using C19orf50 antibody (20492-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 20492-1-PBS in a different storage buffer formulation.

C19orf50 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20492-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

20492-1-PBS targets C19orf50 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13743

  Product name: Recombinant human C19orf50 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC001080

  Sequence: MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTGE

• Full Name: chromosome 19 open reading frame 50
• Calculated Molecular Weight: 176 aa, 20 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC001080
• Gene Symbol: C19orf50
• Gene ID (NCBI): 79036
• RRID: AB_3669335
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQD3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C19orf50, also known as KXD1 (KxDL motif-containing protein 1), a human uncharacterized coiled-coil protein, is a BLOS1-interacting protein. C19orf50 has been shown recently to interact with BLOC-1 subunits and may play a role in lysosome movement and localization at the cell periphery. C19orf50 was evaluated in NSCLC and LUAD (PMID: 33936200, 22554196).