C19orf59 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of THP-1 using 86266-1-RR (same clone as 86266-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 86266-1-RR (C19orf59 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86266-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 86266-1-RR (same clone as 86266-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using C19orf59 antibody (86266-1-RR, Clone: 250141G2 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86266-1-PBS in a different storage buffer formulation.

C19orf59 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86266-1-PBS

Clone No.250141G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Mast cell-expressed membrane protein 1, MCEMP1

---

Product Information

86266-1-PBS targets C19orf59 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22616

  Product name: Recombinant human C19orf59 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-187 aa of BC104798

  Sequence: MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTSQVPAQCRPPSDSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKRELWNVSNSVQACEERQKRGWDSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ

• Full Name: chromosome 19 open reading frame 59
• Observed Molecular Weight: 22/24 kDa
• GenBank Accession Number: BC104798
• Gene Symbol: MCEMP1
• Gene ID (NCBI): 199675
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IX19
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The MCEMP1 gene contains seven exons and was mapped to human chromosome 19p13.3. The epitope-tagged MCEMP1 has been expressed in mammalian cells and found to be localized to the cellular membrane with its C-terminus extending to the outside of the membrane and N-terminus into the cytoplasmic compartment. An evidently increased expression of mast cell expression membrane protein 1 (MCEMP1) has been observed in stroke patients and its expression independently improved the discrimination of 1-month outcome, suggesting the functionality of peripheral blood expression of MCEMP1 as a biomarker for stroke prognosis . (PMID: 30883005, PMID: 31104315, PMID: 15953541)