C19orf59 Recombinant monoclonal antibody

• 

  WB analysis of THP-1 using 86266-1-RR

  THP-1 cells were subjected to SDS PAGE followed by western blot with 86266-1-RR (C19orf59 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of THP-1 using 86266-1-RR

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using C19orf59 antibody (86266-1-RR, Clone: 250141G2 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

C19orf59 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86266-1-RR

Clone No.250141G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Mast cell-expressed membrane protein 1, MCEMP1

---

Tested Applications

• Positive WB detected in: THP-1 cells
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86266-1-RR targets C19orf59 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22616

  Product name: Recombinant human C19orf59 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-187 aa of BC104798

  Sequence: MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTSQVPAQCRPPSDSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKRELWNVSNSVQACEERQKRGWDSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ

• Full Name: chromosome 19 open reading frame 59
• Observed Molecular Weight: 22/24 kDa
• GenBank Accession Number: BC104798
• Gene Symbol: MCEMP1
• Gene ID (NCBI): 199675
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IX19
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The MCEMP1 gene contains seven exons and was mapped to human chromosome 19p13.3. The epitope-tagged MCEMP1 has been expressed in mammalian cells and found to be localized to the cellular membrane with its C-terminus extending to the outside of the membrane and N-terminus into the cytoplasmic compartment. An evidently increased expression of mast cell expression membrane protein 1 (MCEMP1) has been observed in stroke patients and its expression independently improved the discrimination of 1-month outcome, suggesting the functionality of peripheral blood expression of MCEMP1 as a biomarker for stroke prognosis . (PMID: 30883005, PMID: 31104315, PMID: 15953541)