C19orf72 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C19orf72 Polyclonal antibody, PBS Only (29362-1-PBS)

• 

  WB analysis using 29362-1-AP (same clone as 29362-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29362-1-AP (C19orf72 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29362-1-PBS in a different storage buffer formulation.

C19orf72 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29362-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

29362-1-PBS targets C19orf72 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30318

  Product name: Recombinant human C19orf72 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 226-355 aa of BC013280

  Sequence: RSSGSPEPSPAIAKAKEFVADIFRRAKEAKGGVPEEARPALCPGPSGSRCRAHSEPLALCGETAPRDSPPASEAPASEPGYVNYTKLYYVLESGEGTEPEDELEDDKISLPFVVTDLRGRNLRPMRERTA

• Full Name: chromosome 19 open reading frame 72
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC013280
• Gene Symbol: C19orf72
• Gene ID (NCBI): 90379
• RRID: AB_3669685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q66K64
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C19orf72, also called DCAF15 (DDB1- and CUL4-associated factor 15), is the substrate-recognition component of the DCX complex, which is a cullin-4-RING E3 ubiquitin-protein ligase complex that mediates ubiquitination and degradation of target proteins (PMID:16949367; 31452512).