Product Information
24856-1-PBS targets C19orf73 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21567 Product name: Recombinant human C19orf73 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC069712 Sequence: MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQTVVRPAGFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVGGVVLSSAPALRPRLGPCLRPPPSD Predict reactive species |
| Full Name | chromosome 19 open reading frame 73 |
| Calculated Molecular Weight | 129 aa, 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC069712 |
| Gene Symbol | C19orf73 |
| Gene ID (NCBI) | 55150 |
| RRID | AB_3742127 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NVV2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
C19orf73, now officially named Autophagy-related protein 13, is a core regulatory factor in the initiation of cellular autophagy. As a key component of the ULK1/ATG1 complex, this protein plays a critical role in responding to signals such as nutrient deprivation and energy stress. When the mTORC1 pathway is inhibited, ATG13 forms a stable activation complex with proteins including ULK1 and FIP200, initiating autophagosome formation. Dysfunction of ATG13 is closely associated with various diseases: in neurodegenerative disorders, impaired autophagy leads to abnormal protein aggregation; in tumor development, autophagy exerts dual regulatory effects on cancer progression. The expression level and activity of ATG13 are finely regulated by phosphorylation modifications, making it a crucial molecular switch connecting upstream signals with downstream autophagy execution machinery. It has become an important target in both fundamental autophagy research and the development of therapies for related diseases.
